PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010544410.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family MYB_related
Protein Properties Length: 339aa    MW: 38192.5 Da    PI: 9.0326
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010544410.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding409.4e-13108152147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r +WT++E++++++a +++  + Wk+I + +   +t  q++s+ qky
   XP_010544410.1 108 RESWTEQEHDKFLEALQLFDRD-WKKIEAFVR-SKTVIQIRSHAQKY 152
                      789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.59E-16102158IPR009057Homeodomain-like
PROSITE profilePS5129414.503103157IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.5E-6105160IPR009057Homeodomain-like
TIGRFAMsTIGR015576.3E-18106155IPR006447Myb domain, plants
SMARTSM007172.9E-10107155IPR001005SANT/Myb domain
PfamPF002491.6E-10108152IPR001005SANT/Myb domain
CDDcd001676.10E-8110153No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MLSGWLHRSD ISILRERFFT ERGKRELLLA ISSSMVSVNP SPAQGFPFFD PMNVGLPGFN  60
ALAHTLAAEG LGVGHIGAIP MTERSNMMSF SEDPTKKIRK PYTITKSRES WTEQEHDKFL  120
EALQLFDRDW KKIEAFVRSK TVIQIRSHAQ KYFLKAQKNG NSEHLPPPRP KRKATHPYPQ  180
KASKSAAAMP PVNVSFPSEN AMLEPVYLYD TDPRSLLGNP VIKEETGVPA QTITNTCCYS  240
NGSTEDTQRT QTITEPNDQT SCEKLPRVMP NFAEVYSFIG SVFDPNAKGH VQRLKQMDPI  300
NLETVMLLMR NLSVNLTSPE FEGQRRLLSS YNGRATEET
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010544410.10.0PREDICTED: protein REVEILLE 3 isoform X2
SwissprotC0SVG51e-126RVE5_ARATH; Protein REVEILLE 5
TrEMBLV4KZJ01e-136V4KZJ0_EUTSA; Uncharacterized protein
STRINGPOPTR_0014s08520.11e-126(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01280.11e-129MYB_related family protein